SCAMP1 Antibody - middle region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2098699
Article Name: SCAMP1 Antibody - middle region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2098699
Supplier Catalog Number: orb2098699
Alternative Catalog Number: BYT-ORB2098699-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SCAMP1
Conjugation: Biotin
Alternative Names: SCAMP, SCAMP37
SCAMP1 Antibody - middle region : Biotin
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 004857
UniProt: P56603
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LDRREREMQNLSQHGRKNNWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVK