CLTA Antibody - C-terminal region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2098703
Article Name: CLTA Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2098703
Supplier Catalog Number: orb2098703
Alternative Catalog Number: BYT-ORB2098703-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CLTA
Conjugation: HRP
Alternative Names: LCA
CLTA Antibody - C-terminal region : HRP
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 001824
UniProt: P09496
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: KELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDF