NONO Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2125010
| Article Name: |
NONO Antibody - C-terminal region : HRP, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2125010 |
| Supplier Catalog Number: |
orb2125010 |
| Alternative Catalog Number: |
BYT-ORB2125010-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IF, IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human NONO |
| Conjugation: |
HRP |
| Alternative Names: |
P54, NMT55, NRB54, MRXS34, P54NRB, PPP1R114 |
| NONO Antibody - C-terminal region : HRP |
| Clonality: |
Polyclonal |
| Molecular Weight: |
52kDa |
| NCBI: |
031389 |
| UniProt: |
Q15233 |
| Buffer: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Form: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Sequence: |
Synthetic peptide located within the following region: DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY |
