XPOT Antibody - middle region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2125016
Article Name: XPOT Antibody - middle region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2125016
Supplier Catalog Number: orb2125016
Alternative Catalog Number: BYT-ORB2125016-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human XPOT
Conjugation: HRP
Alternative Names: XPO3
XPOT Antibody - middle region : HRP
Clonality: Polyclonal
Molecular Weight: 110kDa
NCBI: 009166
UniProt: O43592
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: TVLSDQQKANVEAIMLAVMKKLTYDEEYNFENEGEDEAMFVEYRKQLKLL