IRAK3 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2125021
Article Name: IRAK3 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2125021
Supplier Catalog Number: orb2125021
Alternative Catalog Number: BYT-ORB2125021-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human IRAK3
Conjugation: Biotin
Alternative Names: ASRT5, IRAKM
IRAK3 Antibody - C-terminal region : Biotin
Clonality: Polyclonal
Molecular Weight: 66kDa
NCBI: 009130
UniProt: Q9Y616
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: NTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVEDDESQNNNLL