LSM6 Antibody - middle region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2125022
Article Name: LSM6 Antibody - middle region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2125022
Supplier Catalog Number: orb2125022
Alternative Catalog Number: BYT-ORB2125022-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LSM6
Conjugation: HRP
Alternative Names: YDR378C
LSM6 Antibody - middle region : HRP
Clonality: Polyclonal
Molecular Weight: 9kDa
NCBI: 009011
UniProt: P62312
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: YRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRR