KRR1 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2125029
Article Name: KRR1 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2125029
Supplier Catalog Number: orb2125029
Alternative Catalog Number: BYT-ORB2125029-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KRR1
Conjugation: FITC
Alternative Names: HRB2, RIP-1
KRR1 Antibody - C-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 008974
UniProt: Q13601
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTET