U1SNRNPBP Antibody - N-terminal region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2125037
Article Name: U1SNRNPBP Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2125037
Supplier Catalog Number: orb2125037
Alternative Catalog Number: BYT-ORB2125037-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human U1SNRNPBP
Conjugation: HRP
Alternative Names: HM-1, U1SNRNPBP
U1SNRNPBP Antibody - N-terminal region : HRP
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 851034
UniProt: Q5XKN9
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR