U1SNRNPBP Antibody - N-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2125038
Article Name: U1SNRNPBP Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2125038
Supplier Catalog Number: orb2125038
Alternative Catalog Number: BYT-ORB2125038-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human U1SNRNPBP
Conjugation: FITC
Alternative Names: HM-1, U1SNRNPBP
U1SNRNPBP Antibody - N-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 851034
UniProt: Q5XKN9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR