CPSF6 Antibody - middle region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2125041
Article Name: CPSF6 Antibody - middle region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2125041
Supplier Catalog Number: orb2125041
Alternative Catalog Number: BYT-ORB2125041-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IF, IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CPSF6
Conjugation: FITC
Alternative Names: CFIM, CFIM68, CFIM72, HPBRII-4, HPBRII-7
CPSF6 Antibody - middle region : FITC
Clonality: Polyclonal
Molecular Weight: 61kDa
NCBI: 008938
UniProt: Q16630
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPP