NUDT21 Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2125043
| Article Name: |
NUDT21 Antibody - N-terminal region : HRP, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2125043 |
| Supplier Catalog Number: |
orb2125043 |
| Alternative Catalog Number: |
BYT-ORB2125043-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human NUDT21 |
| Conjugation: |
HRP |
| Alternative Names: |
CPSF5, CFIM25 |
| NUDT21 Antibody - N-terminal region : HRP |
| Clonality: |
Polyclonal |
| Molecular Weight: |
25kDa |
| NCBI: |
008937 |
| UniProt: |
O43809 |
| Buffer: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Form: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Sequence: |
Synthetic peptide located within the following region: TGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSV |
