SNRPD1 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2125051
Article Name: SNRPD1 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2125051
Supplier Catalog Number: orb2125051
Alternative Catalog Number: BYT-ORB2125051-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SNRPD1
Conjugation: Biotin
Alternative Names: SMD1, SNRPD, Sm-D1, HsT2456
SNRPD1 Antibody - N-terminal region : Biotin
Clonality: Polyclonal
Molecular Weight: 13kDa
NCBI: 008869
UniProt: P62314
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: NGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL