HNRPA0 Antibody - middle region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2125061
Article Name: HNRPA0 Antibody - middle region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2125061
Supplier Catalog Number: orb2125061
Alternative Catalog Number: BYT-ORB2125061-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IF, IHC, IP, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HNRPA0
Conjugation: HRP
Alternative Names: HNRPA0
HNRPA0 Antibody - middle region : HRP
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 006796
UniProt: Q13151
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG