APOBEC2 Antibody - N-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2125068
Article Name: APOBEC2 Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2125068
Supplier Catalog Number: orb2125068
Alternative Catalog Number: BYT-ORB2125068-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC2
Conjugation: FITC
Alternative Names: ARP1, ARCD1
APOBEC2 Antibody - N-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 25kDa
NCBI: 006780
UniProt: Q9Y235
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRN