APOBEC2 Antibody - middle region : Biotin, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2125072
| Article Name: |
APOBEC2 Antibody - middle region : Biotin, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2125072 |
| Supplier Catalog Number: |
orb2125072 |
| Alternative Catalog Number: |
BYT-ORB2125072-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human APOBEC2 |
| Conjugation: |
Biotin |
| Alternative Names: |
ARP1, ARCD1 |
| APOBEC2 Antibody - middle region : Biotin |
| Clonality: |
Polyclonal |
| Molecular Weight: |
26kDa |
| NCBI: |
006780 |
| UniProt: |
Q9Y235 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: CKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADIL |
