SURF6 Antibody - middle region : FITC, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2125074
Article Name: |
SURF6 Antibody - middle region : FITC, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2125074 |
Supplier Catalog Number: |
orb2125074 |
Alternative Catalog Number: |
BYT-ORB2125074-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
IHC, WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human SURF6 |
Conjugation: |
FITC |
Alternative Names: |
RRP14 |
SURF6 Antibody - middle region : FITC |
Clonality: |
Polyclonal |
Molecular Weight: |
40kDa |
NCBI: |
006744 |
UniProt: |
O75683 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequence: |
Synthetic peptide located within the following region: EPREPPGLIFNKVEVSEDEPASKAQRRKEKRQRVKGNLTPLTGRNYRQLL |