CPSF4 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2125081
Article Name: CPSF4 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2125081
Supplier Catalog Number: orb2125081
Alternative Catalog Number: BYT-ORB2125081-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CPSF4
Conjugation: Biotin
Alternative Names: NAR, NEB1, NEB-1, CPSF30
CPSF4 Antibody - C-terminal region : Biotin
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 76662
UniProt: O95639
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SLIQLTSQNSSPNQQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEK