POP4 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2125083
Article Name: |
POP4 Antibody - C-terminal region : FITC, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2125083 |
Supplier Catalog Number: |
orb2125083 |
Alternative Catalog Number: |
BYT-ORB2125083-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
IHC, WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human POP4 |
Conjugation: |
FITC |
Alternative Names: |
RPP29 |
POP4 Antibody - C-terminal region : FITC |
Clonality: |
Polyclonal |
Molecular Weight: |
24kDa |
NCBI: |
006618 |
UniProt: |
O95707 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequence: |
Synthetic peptide located within the following region: EDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTIDL |