SRSF10 Antibody - N-terminal region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2125085
Article Name: SRSF10 Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2125085
Supplier Catalog Number: orb2125085
Alternative Catalog Number: BYT-ORB2125085-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FUSIP1
Conjugation: HRP
Alternative Names: NSSR, TASR, SRp38, TASR1, TASR2, FUSIP1, FUSIP2, SFRS13, SRrp40, SFRS13A, PPP1R149
SRSF10 Antibody - N-terminal region : HRP
Clonality: Polyclonal
Molecular Weight: 31kDa
NCBI: 473357
UniProt: O75494
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRP