SARS Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2125122
Article Name: SARS Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2125122
Supplier Catalog Number: orb2125122
Alternative Catalog Number: BYT-ORB2125122-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SARS
Conjugation: FITC
Alternative Names: SARS, SERS, SERRS, NEDMAS
SARS Antibody - C-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 006504
UniProt: Q5T5C8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTL