PRPF8 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2125138
Article Name: PRPF8 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2125138
Supplier Catalog Number: orb2125138
Alternative Catalog Number: BYT-ORB2125138-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRPF8
Conjugation: Biotin
Alternative Names: PRP8, RP13, HPRP8, PRPC8, SNRNP220
PRPF8 Antibody - N-terminal region : Biotin
Clonality: Polyclonal
Molecular Weight: 273kDa
NCBI: 006436
UniProt: Q6P2Q9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPR