RNASEH2A Antibody - middle region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2125139
Article Name: RNASEH2A Antibody - middle region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2125139
Supplier Catalog Number: orb2125139
Alternative Catalog Number: BYT-ORB2125139-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RNASEH2A
Conjugation: HRP
Alternative Names: AGS4, JUNB, RNHL, RNHIA, THSD8, RNASEHI
RNASEH2A Antibody - middle region : HRP
Clonality: Polyclonal
Molecular Weight: 33kDa
NCBI: 006388
UniProt: O75792
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE