RNASEH2A Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2125143
Article Name: RNASEH2A Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2125143
Supplier Catalog Number: orb2125143
Alternative Catalog Number: BYT-ORB2125143-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RNASEH2A
Conjugation: FITC
Alternative Names: AGS4, JUNB, RNHL, RNHIA, THSD8, RNASEHI
RNASEH2A Antibody - C-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 33kDa
NCBI: 006388
UniProt: O75792
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLERGLES