NOL5A Antibody - middle region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2125148
Article Name: NOL5A Antibody - middle region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2125148
Supplier Catalog Number: orb2125148
Alternative Catalog Number: BYT-ORB2125148-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NOL5A
Conjugation: HRP
Alternative Names: NOL5A, SCA36
NOL5A Antibody - middle region : HRP
Clonality: Polyclonal
Molecular Weight: 66kDa
NCBI: 006383
UniProt: O00567
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: YGYHFPELVKIINDNATYCRLAQFIGNRRELNEDKLEKLEELTMDGAKAK