NOL5A Antibody - middle region : FITC, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2125149
Article Name: |
NOL5A Antibody - middle region : FITC, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2125149 |
Supplier Catalog Number: |
orb2125149 |
Alternative Catalog Number: |
BYT-ORB2125149-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
IHC, WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human NOL5A |
Conjugation: |
FITC |
Alternative Names: |
NOL5A, SCA36 |
NOL5A Antibody - middle region : FITC |
Clonality: |
Polyclonal |
Molecular Weight: |
66kDa |
NCBI: |
006383 |
UniProt: |
O00567 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequence: |
Synthetic peptide located within the following region: YGYHFPELVKIINDNATYCRLAQFIGNRRELNEDKLEKLEELTMDGAKAK |