NOL5A Antibody - middle region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2125150
Article Name: NOL5A Antibody - middle region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2125150
Supplier Catalog Number: orb2125150
Alternative Catalog Number: BYT-ORB2125150-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NOL5A
Conjugation: Biotin
Alternative Names: NOL5A, SCA36
NOL5A Antibody - middle region : Biotin
Clonality: Polyclonal
Molecular Weight: 66kDa
NCBI: 006383
UniProt: O00567
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: YGYHFPELVKIINDNATYCRLAQFIGNRRELNEDKLEKLEELTMDGAKAK