CHERP Antibody - middle region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2125151
Article Name: CHERP Antibody - middle region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2125151
Supplier Catalog Number: orb2125151
Alternative Catalog Number: BYT-ORB2125151-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHERP
Conjugation: HRP
Alternative Names: SRA1, DAN16, SCAF6
CHERP Antibody - middle region : HRP
Clonality: Polyclonal
Molecular Weight: 104kDa
NCBI: 006378
UniProt: Q8IWX8
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: EQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRNKSYSFIARMKARD