CHERP Antibody - middle region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2125152
Article Name: CHERP Antibody - middle region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2125152
Supplier Catalog Number: orb2125152
Alternative Catalog Number: BYT-ORB2125152-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHERP
Conjugation: FITC
Alternative Names: SRA1, DAN16, SCAF6
CHERP Antibody - middle region : FITC
Clonality: Polyclonal
Molecular Weight: 104kDa
NCBI: 006378
UniProt: Q8IWX8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRNKSYSFIARMKARD