SYNCRIP Antibody - middle region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2125159
Article Name: SYNCRIP Antibody - middle region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2125159
Supplier Catalog Number: orb2125159
Alternative Catalog Number: BYT-ORB2125159-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SYNCRIP
Conjugation: Biotin
Alternative Names: PP68, NSAP1, GRYRBP, HNRNPQ, HNRPQ1, GRY-RBP, hnRNP-Q
SYNCRIP Antibody - middle region : Biotin
Clonality: Polyclonal
Molecular Weight: 69kDa
NCBI: 006363
UniProt: O60506
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: IEIVFAKPPDQKRKERKAQRQAAKNQMYDDYYYYGPPHMPPPTRGRGRGG