NXF1 Antibody - N-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2125167
Article Name: NXF1 Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2125167
Supplier Catalog Number: orb2125167
Alternative Catalog Number: BYT-ORB2125167-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NXF1
Conjugation: FITC
Alternative Names: TAP, MEX67
NXF1 Antibody - N-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 68kDa
NCBI: 006353
UniProt: Q9UBU9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWFKITIPYG