EMG1 Antibody - C-terminal region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2125169
Article Name: EMG1 Antibody - C-terminal region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2125169
Supplier Catalog Number: orb2125169
Alternative Catalog Number: BYT-ORB2125169-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human EMG1
Conjugation: HRP
Alternative Names: C2F, NEP1, Grcc2f
EMG1 Antibody - C-terminal region : HRP
Clonality: Polyclonal
Molecular Weight: 26kDa
NCBI: 006322
UniProt: Q92979
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: VSDVRELVPSSDPIVFVVGAFAHGKVSVEYTEKMVSISNYPLSAALTCAK