RBM14 Antibody - N-terminal region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2125175
Article Name: RBM14 Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2125175
Supplier Catalog Number: orb2125175
Alternative Catalog Number: BYT-ORB2125175-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RBM14
Conjugation: HRP
Alternative Names: SIP, COAA, PSP2, SYTIP1, TMEM137
RBM14 Antibody - N-terminal region : HRP
Clonality: Polyclonal
Molecular Weight: 69kDa
NCBI: 006319
UniProt: Q96PK6
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: YAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGD