RBM14 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2125177
Article Name: RBM14 Antibody - N-terminal region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2125177
Supplier Catalog Number: orb2125177
Alternative Catalog Number: BYT-ORB2125177-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RBM14
Conjugation: Biotin
Alternative Names: SIP, COAA, PSP2, SYTIP1, TMEM137
RBM14 Antibody - N-terminal region : Biotin
Clonality: Polyclonal
Molecular Weight: 69kDa
NCBI: 006319
UniProt: Q96PK6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: YAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGD