PCBP1 Antibody - middle region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2125182
Article Name: PCBP1 Antibody - middle region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2125182
Supplier Catalog Number: orb2125182
Alternative Catalog Number: BYT-ORB2125182-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human PCBP1
Conjugation: FITC
Alternative Names: HNRPX, HNRPE1, hnRNP-X, HEL-S-85, hnRNP-E1
PCBP1 Antibody - middle region : FITC
Clonality: Polyclonal
Molecular Weight: 37kDa
NCBI: 006187
UniProt: Q15365
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGF