RACK1 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2125198
| Article Name: |
RACK1 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2125198 |
| Supplier Catalog Number: |
orb2125198 |
| Alternative Catalog Number: |
BYT-ORB2125198-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human GNB2L1 |
| Conjugation: |
Biotin |
| Alternative Names: |
H12.3, HLC-7, PIG21, GNB2L1, Gnb2-rs1 |
| RACK1 Antibody - C-terminal region : Biotin |
| Clonality: |
Polyclonal |
| Molecular Weight: |
35kDa |
| NCBI: |
006089 |
| UniProt: |
P63244 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: LEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVW |
