RBM12 Antibody - N-terminal region : HRP, Rabbit, Polyclonal

Catalog Number: BYT-ORB2125202
Article Name: RBM12 Antibody - N-terminal region : HRP, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2125202
Supplier Catalog Number: orb2125202
Alternative Catalog Number: BYT-ORB2125202-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RBM12
Conjugation: HRP
Alternative Names: SWAN, SCZD19, HRIHFB2091
RBM12 Antibody - N-terminal region : HRP
Clonality: Polyclonal
Molecular Weight: 97kDa
NCBI: 006038
UniProt: Q9NTZ6
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: PPPSSGMSSRVNLPTTVSNFNNPSPSVVTATTSVHESNKNIQTFSTASVG