MCM7 Antibody - N-terminal region : FITC, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2131444
Article Name: |
MCM7 Antibody - N-terminal region : FITC, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2131444 |
Supplier Catalog Number: |
orb2131444 |
Alternative Catalog Number: |
BYT-ORB2131444-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human MCM7 |
Conjugation: |
FITC |
Alternative Names: |
MCM2, CDC47, P85MCM, P1CDC47, PNAS146, PPP1R104, P1.1-MCM3 |
MCM7 Antibody - N-terminal region : FITC |
Clonality: |
Polyclonal |
Molecular Weight: |
42kDa |
NCBI: |
877577 |
UniProt: |
P33993 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequence: |
Synthetic peptide located within the following region: KYGNQLVRLAHREQVALYVDLDDVAEDDPELVDSICENARRYAKLFADAV |