AKAP7 Antibody - middle region : FITC, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2131447
| Article Name: |
AKAP7 Antibody - middle region : FITC, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2131447 |
| Supplier Catalog Number: |
orb2131447 |
| Alternative Catalog Number: |
BYT-ORB2131447-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human AKAP7 |
| Conjugation: |
FITC |
| Alternative Names: |
AKAP15, AKAP18 |
| AKAP7 Antibody - middle region : FITC |
| Clonality: |
Polyclonal |
| Molecular Weight: |
37kDa |
| NCBI: |
057461 |
| UniProt: |
Q9P0M2 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: TLLVMQLLNEDEVNIGIDALLELKPFIEELLQGKHLTLPFQGIGTFGNQV |
