ANXA10 Antibody - middle region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2131450
Article Name: ANXA10 Antibody - middle region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2131450
Supplier Catalog Number: orb2131450
Alternative Catalog Number: BYT-ORB2131450-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ANXA10
Conjugation: FITC
Alternative Names: ANX14
ANXA10 Antibody - middle region : FITC
Clonality: Polyclonal
Molecular Weight: 37kDa
NCBI: 009124
UniProt: Q9UJ72
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VLWEACQQKTGEHKTMLQMILCNKSYQQLRLVFQEFQNISGQDMVDAINE