RUNX2 Antibody - middle region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2131466
Article Name: RUNX2 Antibody - middle region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2131466
Supplier Catalog Number: orb2131466
Alternative Catalog Number: BYT-ORB2131466-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RUNX2
Conjugation: Biotin
Alternative Names: CCD, AML3, CCD1, CLCD, OSF2, CBFA1, OSF-2, PEA2aA, PEBP2aA, CBF-alpha-1
RUNX2 Antibody - middle region : Biotin
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 001019801
UniProt: Q13950
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM