RUNX2 Antibody - middle region : FITC, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2131468
| Article Name: |
RUNX2 Antibody - middle region : FITC, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2131468 |
| Supplier Catalog Number: |
orb2131468 |
| Alternative Catalog Number: |
BYT-ORB2131468-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human RUNX2 |
| Conjugation: |
FITC |
| Alternative Names: |
CCD, AML3, CCD1, CLCD, OSF2, CBFA1, OSF-2, PEA2aA, PEBP2aA, CBF-alpha-1 |
| RUNX2 Antibody - middle region : FITC |
| Clonality: |
Polyclonal |
| Molecular Weight: |
57kDa |
| NCBI: |
001019801 |
| UniProt: |
Q13950 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM |
