SPP1 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2131471
Article Name: SPP1 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2131471
Supplier Catalog Number: orb2131471
Alternative Catalog Number: BYT-ORB2131471-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SPP1
Conjugation: FITC
Alternative Names: OPN, BNSP, BSPI, ETA-1
SPP1 Antibody - C-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 33kDa
NCBI: 000573
UniProt: P10451
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DSQELSKVSREFHSHEFHSHEDMLVVDPKSKEEDKHLKFRISHELDSASS