CRLF1 Antibody - middle region : HRP, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2131476
Article Name: |
CRLF1 Antibody - middle region : HRP, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2131476 |
Supplier Catalog Number: |
orb2131476 |
Alternative Catalog Number: |
BYT-ORB2131476-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human CRLF1 |
Conjugation: |
HRP |
Alternative Names: |
CLF, NR6, CISS, CISS1, CLF-1, zcytor5 |
CRLF1 Antibody - middle region : HRP |
Clonality: |
Polyclonal |
Molecular Weight: |
46kDa |
NCBI: |
004741 |
UniProt: |
O75462 |
Buffer: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Form: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Sequence: |
Synthetic peptide located within the following region: QLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGL |