CRLF1 Antibody - middle region : HRP, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2131476
| Article Name: |
CRLF1 Antibody - middle region : HRP, Rabbit, Polyclonal |
| Biozol Catalog Number: |
BYT-ORB2131476 |
| Supplier Catalog Number: |
orb2131476 |
| Alternative Catalog Number: |
BYT-ORB2131476-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human CRLF1 |
| Conjugation: |
HRP |
| Alternative Names: |
CLF, NR6, CISS, CISS1, CLF-1, zcytor5 |
| CRLF1 Antibody - middle region : HRP |
| Clonality: |
Polyclonal |
| Molecular Weight: |
46kDa |
| NCBI: |
004741 |
| UniProt: |
O75462 |
| Buffer: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Form: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Sequence: |
Synthetic peptide located within the following region: QLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGL |
