MCM7 Antibody - middle region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2131520
Article Name: MCM7 Antibody - middle region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2131520
Supplier Catalog Number: orb2131520
Alternative Catalog Number: BYT-ORB2131520-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MCM7
Conjugation: Biotin
Alternative Names: MCM2, CDC47, P85MCM, P1CDC47, PNAS146, PPP1R104, P1.1-MCM3
MCM7 Antibody - middle region : Biotin
Clonality: Polyclonal
Molecular Weight: 81kDa
NCBI: 005907
UniProt: P33993
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: HRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDV