MCM6 Antibody - middle region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2131523
Article Name: MCM6 Antibody - middle region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2131523
Supplier Catalog Number: orb2131523
Alternative Catalog Number: BYT-ORB2131523-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MCM6
Conjugation: Biotin
Alternative Names: Mis5, P105MCM, MCG40308
MCM6 Antibody - middle region : Biotin
Clonality: Polyclonal
Molecular Weight: 90kDa
UniProt: Q14566
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: CVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLC