MCM6 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Catalog Number:
BYT-ORB2131526
Article Name: |
MCM6 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal |
Biozol Catalog Number: |
BYT-ORB2131526 |
Supplier Catalog Number: |
orb2131526 |
Alternative Catalog Number: |
BYT-ORB2131526-100 |
Manufacturer: |
Biorbyt |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
IHC, WB |
Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human MCM6 |
Conjugation: |
Biotin |
Alternative Names: |
Mis5, P105MCM, MCG40308 |
MCM6 Antibody - C-terminal region : Biotin |
Clonality: |
Polyclonal |
Molecular Weight: |
90kDa |
NCBI: |
005906 |
UniProt: |
Q14566 |
Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Sequence: |
Synthetic peptide located within the following region: RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE |