MCM6 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2131529
Article Name: MCM6 Antibody - C-terminal region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2131529
Supplier Catalog Number: orb2131529
Alternative Catalog Number: BYT-ORB2131529-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MCM6
Conjugation: Biotin
Alternative Names: Mis5, P105MCM, MCG40308
MCM6 Antibody - C-terminal region : Biotin
Clonality: Polyclonal
Molecular Weight: 90kDa
NCBI: 005906
UniProt: Q14566
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE