MCM2 Antibody - middle region : Biotin, Rabbit, Polyclonal

Catalog Number: BYT-ORB2131541
Article Name: MCM2 Antibody - middle region : Biotin, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2131541
Supplier Catalog Number: orb2131541
Alternative Catalog Number: BYT-ORB2131541-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MCM2
Conjugation: Biotin
Alternative Names: BM28, CCNL1, CDCL1, cdc19, DFNA70, D3S3194, MITOTIN
MCM2 Antibody - middle region : Biotin
Clonality: Polyclonal
Molecular Weight: 102kDa
NCBI: 004517
UniProt: P49736
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: NNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNL