MCM3 Antibody - C-terminal region : FITC, Rabbit, Polyclonal

Catalog Number: BYT-ORB2131549
Article Name: MCM3 Antibody - C-terminal region : FITC, Rabbit, Polyclonal
Biozol Catalog Number: BYT-ORB2131549
Supplier Catalog Number: orb2131549
Alternative Catalog Number: BYT-ORB2131549-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MCM3
Conjugation: FITC
Alternative Names: HCC5, P1.h, RLFB, P1-MCM3
MCM3 Antibody - C-terminal region : FITC
Clonality: Polyclonal
Molecular Weight: 91kDa
NCBI: 002379
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: YAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAK