A synthetic peptide corresponding to a sequence in the middle region of human Bmi1 (135-165aa IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR), different from the related mouse sequence by four amino acids.
Conjugation:
Unconjugated
Alternative Names:
Polycomb complex protein BMI-1,Polycomb group RING finger protein 4,RING finger protein 51,BMI1,PCGF4, RNF51,
Bmi1 Antibody
Clonality:
Polyclonal
Concentration:
Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
WB: The detection limit for Bmi1 is approximately 0.25ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.
* VAT and and shipping costs not included. Errors and price changes excepted
